DPCfam | MC449865
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 0.47 |
| Predicted disordered residues (%) | 10.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18371 |
| Sequences matching dominant architecture (%) | 95.08 |
| Average overlap percent | 76.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000642E912 | 368-439 | 72 | WRDFDRSKLYTADLESGLHYLLRVELATRRALAGAELKALRDFVTVLAKLLPSRPPVRKLLEMLQEWLTSLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077YX42-F1 | 203-282 | 97.53 | 90.46 | View in AlphaFoldDB ↗ |