DPCfam | MC4498
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Residues in low-complexity regions (%) | 0.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16254 |
| Sequences matching dominant architecture (%) | 94.05 |
| Average overlap percent | 29.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N0LTZ7 | 11-113 | 103 | MYELAQRLFKIPRSLSGNGNRETLRIINSILGGNLKVYEVPSHTQAFDWEIPKEWNVNEAYIITPSGEKICDFGENNLHLVGYSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q97H19-F1 | 18-117 | 99.01 | 98.72 | View in AlphaFoldDB ↗ |