DPCfam | MC449781
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 1.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05133 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.33 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002CB4A01 | 45-126 | 82 | VSKYIEHHMDYQRPRLKVLSDYYEGKTKNLVELTRRKEEYMADNRVAHDYASYISDFINGYFLGNPIQYQDDDKDVLEAIEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FX52-F1 | 44-119 | 96.10 | 88.51 | View in AlphaFoldDB ↗ |