DPCfam | MC44961
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 299 ± 37 aa |
| Residues in low-complexity regions (%) | 1.97 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 9.85 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF12231 |
| Sequences matching dominant architecture (%) | 93.5 |
| Average overlap percent | 84.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007F8EB1D | 60-355 | 296 | FGKAILVHLTSPSAELSQAALQALGFCVYHSHVVAGVPEVFAAQILSTLCSLVMKATDKNTCTRALWVISKQNFPACIVAKNVPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7ML30-F1 | 42-373 | 99.67 | 84.87 | View in AlphaFoldDB ↗ |