DPCfam | MC44942
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 203 ± 37 aa |
| Residues in low-complexity regions (%) | 1.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.57 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12456 |
| Sequences matching dominant architecture (%) | 89.23 |
| Average overlap percent | 46.21 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9FRH0 | 93-345 | 252 | SQGYFSSRNYMFAIENCKRILTRGEPENHGVFVGSWLLTMVDHWDNEKERLILLYSRTLFIVKYDFITTTLQSFETYALQKIIHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8A4V5-F1 | 63-275 | 99.53 | 84.32 | View in AlphaFoldDB ↗ |