DPCfam | MC449199
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 427 ± 49 aa |
| Residues in low-complexity regions (%) | 2.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06458- PF06458 |
| Sequences matching dominant architecture (%) | 38.78 |
| Average overlap percent | 30.72 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R1ZKR3 | 247-562 | 316 | IDEWMPDYAFQYLLWYTNFRAQYSTITLFRDNFTKNSLANVTKIYVTEGSQSTSGSGLQYYMALMSMASMEGLQYATNLKEIYMV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8Y3L4-F1 | 275-646 | 92.20 | 93.27 | View in AlphaFoldDB ↗ |