DPCfam | MC449145
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 203 ± 32 aa |
| Residues in low-complexity regions (%) | 2.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.08 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D3BN00 | 182-383 | 202 | IKITDSSIESARGGDSLLMDIFIRRKDLYLSDFVSSDSPTASTRNGNRSNSDPKKQFSNDRPPLPGQQYPGLGIAKQMDQLLVQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54JN6-F1 | 198-482 | 99.53 | 83.83 | View in AlphaFoldDB ↗ |