DPCfam | MC449042
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 59 ± 8 aa |
| Residues in low-complexity regions (%) | 9.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.9 |
| Average transmembrane regions | 1.87 |
| Dominant Pfam architecture(s) | PF01794 |
| Sequences matching dominant architecture (%) | 98.05 |
| Average overlap percent | 39.02 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0T6B4H3 | 104-168 | 65 | LLTTKPGFGGLVPGLAFPTGIVLVVILTVIFICSQPFVRRRGSFEVFYWTHTLYIPFWILLILHC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FIJ0-F1 | 510-575 | 98.18 | 87.66 | View in AlphaFoldDB ↗ |