DPCfam | MC448907
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 143 ± 25 aa |
| Residues in low-complexity regions (%) | 2.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12234 |
| Sequences matching dominant architecture (%) | 96.58 |
| Average overlap percent | 28.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7TJT9 | 2206-2360 | 155 | AAAITEKLTQIALPQLSRQEQINLADIVECVAIVEHQRRSMDDNAARFMLFFRQHVLRRGRANEVSLSWREINWAYHSNSQDILA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q409-F1 | 290-460 | 98.56 | 68.61 | View in AlphaFoldDB ↗ |