DPCfam | MC448681
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 392 ± 56 aa |
| Residues in low-complexity regions (%) | 23.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 67.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15996 |
| Sequences matching dominant architecture (%) | 80.56 |
| Average overlap percent | 40.07 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B3RYE3 | 49-336 | 288 | WAQKAAEWIKHKESVSHRNNDLSGQFAHGGEMGFDGRHPSHFYPHDANFEQDRLQQSNVDHYNYSAMSGNEILYDNESSQHMQHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86B99-F1 | 76-506 | 95.41 | 52.59 | View in AlphaFoldDB ↗ |