DPCfam | MC448645
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 287 ± 45 aa |
| Residues in low-complexity regions (%) | 5.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.28 |
| Average transmembrane regions | 0.72 |
| Dominant Pfam architecture(s) | PF02460 |
| Sequences matching dominant architecture (%) | 7.46 |
| Average overlap percent | 12.36 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7U3K7 | 3-231 | 229 | GLEPHGTDIGKRMTAWNKLQENTGPGRSLSLLPRQLSNQPAISYGHGSREGHPSLRLKRMVDWNSAQDSSFCDSPGERYAQLVFR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96F81-F1 | 181-438 | 99.25 | 80.29 | View in AlphaFoldDB ↗ |