DPCfam | MC44864
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1621 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.96 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01624- PF05188 |
| Sequences matching dominant architecture (%) | 53.63 |
| Average overlap percent | 55.97 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T2MF78 | 325-458 | 134 | QSKEMSPGMKQWWLLKKDLFDTVIFFKVGKFYELYHMDAVIGVAELGLVFMKGKFAHCGFPEVAFGRYSEVLVQRGYKVARVEQT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6LLR1-F1 | 7-128 | 96.75 | 90.14 | View in AlphaFoldDB ↗ |