DPCfam | MC448475
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 469 ± 74 aa |
| Residues in low-complexity regions (%) | 8.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00498 |
| Sequences matching dominant architecture (%) | 44.33 |
| Average overlap percent | 11.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G4JZF4 | 4-560 | 557 | QFPPSSPIAASESRGEDPFYQPDGKHLGSTLDFFKKKTGASNVVDYPTPNPSSTLGKSSPVKARPACDTSFQTPSECELEEELRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PS18-F1 | 38-597 | 99.36 | 62.90 | View in AlphaFoldDB ↗ |