DPCfam | MC448323
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 155 ± 26 aa |
| Residues in low-complexity regions (%) | 7.38 |
| Residues in coiled-coil regions (%) | 2.07 |
| Predicted disordered residues (%) | 56.02 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF08228 |
| Sequences matching dominant architecture (%) | 68.18 |
| Average overlap percent | 10.98 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166CFW2 | 15-236 | 222 | AHNQSGVRANPKKSKAKPSDPSQRKVVYKSVLDNPQEVSWPNVPLNLQNTILARVVDLITESGISKFLQNRESRARHEKNKRRKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VV03-F1 | 8-64 | 34.15 | 82.99 | View in AlphaFoldDB ↗ |