DPCfam | MC448075
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1061 |
|---|---|
| Mean domain length (aa) | 280 ± 48 aa |
| Residues in low-complexity regions (%) | 6.73 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 3.0 |
| Average transmembrane regions | 5.16 |
| Dominant Pfam architecture(s) | PF04515 |
| Sequences matching dominant architecture (%) | 94.44 |
| Average overlap percent | 82.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T0QKN6 | 205-480 | 276 | SYWCCQLLSNVGEDDGWSIGLLWLLFHFYWTSHFFKTLISVVVSGTVMYWYHHWGDDQPESPTVPMVLTSPRSSLRTASIEMEPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6IP59-F1 | 350-692 | 99.30 | 88.95 | View in AlphaFoldDB ↗ |