DPCfam | MC448049
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.53 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13481 |
| Sequences matching dominant architecture (%) | 2.04 |
| Average overlap percent | 41.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077FD013 | 29-170 | 142 | NKESCVILSDNSLLKSSLLFQAALSYASIGDQVIFICTGPFLAKPCPVSEMQTATPLTLECIKMVYISEPSGLLQYLCELHTKEC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54KV9-F1 | 27-152 | 97.60 | 89.22 | View in AlphaFoldDB ↗ |