DPCfam | MC44747
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 233 ± 23 aa |
| Residues in low-complexity regions (%) | 1.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.04 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF12937 |
| Sequences matching dominant architecture (%) | 23.44 |
| Average overlap percent | 25.8 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067U2P8 | 55-288 | 234 | VVVNSSGLAIFPDELLLEILGHYPEIPFPTVEQQEFNANDHIARRETLLALSKTCRNLRRFFRPYIWHRIEVCAGMRVENHILQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KLC7-F1 | 129-246 | 44.96 | 96.44 | View in AlphaFoldDB ↗ |