DPCfam | MC447291
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 353 ± 48 aa |
| Residues in low-complexity regions (%) | 1.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.94 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13716 |
| Sequences matching dominant architecture (%) | 74.75 |
| Average overlap percent | 37.18 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4VC12 | 1476-1856 | 381 | GGGCGVGGGGGSCMISFISDDLIHALHRLLFTNQSKIGDYLASNRDWKAVGRQPYDKMVTLLAHLGPPGHKSVDCMWNYLDIPST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VSC9-F1 | 1464-1819 | 99.71 | 74.32 | View in AlphaFoldDB ↗ |