DPCfam | MC447104
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.71 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02735 |
| Sequences matching dominant architecture (%) | 98.2 |
| Average overlap percent | 45.41 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D3Q8B5 | 1-83 | 83 | MRASWKGSIVWSLVSMPVKLVPATEDKDVRFHQVHRTDGGRIRQRRFCEIEDVEVPYSEIAKGYELQSGEVVILEKSDFDALP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0TIF2-F1 | 4-90 | 98.86 | 90.24 | View in AlphaFoldDB ↗ |