DPCfam | MC447036
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Residues in low-complexity regions (%) | 12.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.03 |
| Average transmembrane regions | 1.1 |
| Dominant Pfam architecture(s) | PF09594 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 16.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F1L235 | 39-112 | 74 | PLDLAIYLKGGAEVAQGQPLYDGPLIFDLPFTYPPFAGVVFAGLDPLSDNATMALWHGATFLALFAVVALALRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0R036-F1 | 45-123 | 98.70 | 94.41 | View in AlphaFoldDB ↗ |