DPCfam | MC44692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Residues in low-complexity regions (%) | 2.19 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 23.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00797 |
| Sequences matching dominant architecture (%) | 98.85 |
| Average overlap percent | 40.57 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D8FSW4 | 158-297 | 140 | LEYKSLSQHTDPTNQRIWVYSTQENPSAPWKEMYCFAADTEFFPADFEVMNLSTMTSPQSFFVQTVMCMWLLLNDNNNNDDDNKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WIP1-F1 | 177-286 | 99.00 | 96.21 | View in AlphaFoldDB ↗ |