DPCfam | MC44668
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 190 ± 33 aa |
| Residues in low-complexity regions (%) | 10.33 |
| Residues in coiled-coil regions (%) | 2.04 |
| Predicted disordered residues (%) | 23.74 |
| Average transmembrane regions | 1.66 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M2LU63 | 16-195 | 180 | DVLAPSLRVGAICGCAGFLIGGTSGILKGTTPFLFATASAIQTFALGTTYWTCRSAFLQSRFAIGQSPRDCTKASTVAGGVSGGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VXR9-F1 | 52-218 | 99.51 | 84.57 | View in AlphaFoldDB ↗ |