DPCfam | MC446651
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01609 |
| Sequences matching dominant architecture (%) | 6.9 |
| Average overlap percent | 50.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J9D0A4 | 114-227 | 114 | LLSRVFQEQYDKDKDGVVHVREKKLISAKSVQNPHDPDAQYRSKNGKKIKGYSTNITETTDEKDKPSLITDIQIKGASAADNGFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4ING3-F1 | 168-212 | 36.22 | 55.74 | View in AlphaFoldDB ↗ |