DPCfam | MC445876
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 681 |
|---|---|
| Mean domain length (aa) | 96 ± 21 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 16.45 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00208 |
| Sequences matching dominant architecture (%) | 99.0 |
| Average overlap percent | 39.68 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1YGW1 | 304-393 | 90 | DKILSQNGVLLAPDILANAGGVTVSYFEQVQNAANYYWTEDEALTKLEKIMVSAFEAVWERKEKYGVDMRTAAFVSALERISAAM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z3F9-F1 | 898-1039 | 98.90 | 88.11 | View in AlphaFoldDB ↗ |