DPCfam | MC445705
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 85 ± 15 aa |
| Residues in low-complexity regions (%) | 6.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.59 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067KAF7 | 4-88 | 85 | LVKSSSFFLILIVIINFGFIETEGRPLKTRNYSATRVIEGFLDGFSLGAIKESGPSPGAGHKYANAQTLGGIKDSGPSPPGEGHK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C6TFH4-F1 | 2-88 | 98.85 | 63.41 | View in AlphaFoldDB ↗ |