DPCfam | MC445609
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 187 ± 29 aa |
| Residues in low-complexity regions (%) | 2.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.48 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF10075 |
| Sequences matching dominant architecture (%) | 93.21 |
| Average overlap percent | 68.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A177B4N6 | 97-277 | 181 | LRGYQRTNPDNCAMLKACVDYQIKKEKYYLDANLALLKLYQFDPCLYSNSEPIINILLKSIMNLPKSDFLACTALVNPNNISSEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UBQ5-F1 | 13-206 | 98.97 | 86.73 | View in AlphaFoldDB ↗ |