DPCfam | MC44550
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Residues in low-complexity regions (%) | 24.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.08 |
| Average transmembrane regions | 1.98 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000688CE01 | 189-270 | 81 | EDFVPSRRGRGGYDPESDAMARRVRYRFRQRTALGLTLSALMFGGFAFAVTPVLWWACALAVVTLGGYLAYLRRQVRLEED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FCW4-F1 | 222-302 | 98.78 | 84.05 | View in AlphaFoldDB ↗ |