DPCfam | MC445158
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 443 ± 68 aa |
| Residues in low-complexity regions (%) | 8.88 |
| Residues in coiled-coil regions (%) | 22.12 |
| Predicted disordered residues (%) | 37.33 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF02185- PF02185- PF02185 |
| Sequences matching dominant architecture (%) | 45.19 |
| Average overlap percent | 51.96 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2VT86 | 73-516 | 444 | MRIKQGYVQMQKVTKERKQSEFLKKEVRDLSDQISEMQDDLQTLDMYDTGAFDDGEESALGMATSPSDDAITTQVSDAMGGIDSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7MBL8-F1 | 43-494 | 99.78 | 71.12 | View in AlphaFoldDB ↗ |