DPCfam | MC445013
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Residues in low-complexity regions (%) | 1.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02880 |
| Sequences matching dominant architecture (%) | 99.3 |
| Average overlap percent | 50.1 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V2LGQ6 | 327-395 | 69 | VQKQTNLDKMYMINSTVSSQMLGSMADKLGFGFVDTLTGFKWIGNKAIELEKKGYNVPFAFEEAIGFMF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z9C5-F1 | 976-1032 | 95.00 | 92.08 | View in AlphaFoldDB ↗ |