DPCfam | MC444754
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 209 ± 19 aa |
| Residues in low-complexity regions (%) | 8.6 |
| Residues in coiled-coil regions (%) | 1.56 |
| Predicted disordered residues (%) | 46.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008744DD0 | 1267-1479 | 213 | GTKSDGENQANSDEEVSTDRGYTSDSELTKSPKHGQQRPHSPLIVPTSPIGTPNTGGWILVGNEGEIQPVVGRTVPPTQYGLSLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A286Y9X1-F1 | 1304-1525 | 100.00 | 53.53 | View in AlphaFoldDB ↗ |