DPCfam | MC444336
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 235 ± 39 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03894- PF09363 |
| Sequences matching dominant architecture (%) | 76.85 |
| Average overlap percent | 69.93 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G2VV97 | 21-230 | 210 | LAVLRRCLASKNEINIIVAGKTQEPRWLTPTLAEEELKRGLMTWDFASDSDPDLVLAAAGDYMTKEALAALSIVKQEAPEILLRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7NLX2-F1 | 516-785 | 100.00 | 97.68 | View in AlphaFoldDB ↗ |