DPCfam | MC444213
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 211 ± 26 aa |
| Residues in low-complexity regions (%) | 8.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.58 |
| Average transmembrane regions | 4.98 |
| Dominant Pfam architecture(s) | PF10086 |
| Sequences matching dominant architecture (%) | 84.83 |
| Average overlap percent | 90.79 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000760FF80 | 3-160 | 158 | LYALFLGVSAALFETLGRLFVVNICLKKRKGWLEGAVAGWGHGFCEAFIMLGITYISYIYYAFLINQGTLATMGLDPSSVASITT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O07601-F1 | 17-243 | 98.68 | 96.52 | View in AlphaFoldDB ↗ |