DPCfam | MC444147
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 388 ± 76 aa |
| Residues in low-complexity regions (%) | 14.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.86 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A078HXW3 | 197-527 | 331 | IPLLVPLGTRSLSHAPTSQPDENSHQSFPEHIMSTLLQTPALYTAASFASTFGGGPQGNLAAMAAATVAAASAWWAANGMLPLCA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7KZP5-F1 | 324-746 | 100.00 | 50.25 | View in AlphaFoldDB ↗ |