DPCfam | MC443936
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Residues in low-complexity regions (%) | 5.94 |
| Residues in coiled-coil regions (%) | 48.32 |
| Predicted disordered residues (%) | 28.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00170 |
| Sequences matching dominant architecture (%) | 88.89 |
| Average overlap percent | 17.19 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4SP41 | 48-150 | 103 | HLIADISRYQKENGQIRAMISLVTQAYSNLMNENAVLRSQLAQLQHRLHSLNGLIASTNAVYFDQPATLQFLANCTSNELIVDDY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0GPF8-F1 | 59-158 | 97.94 | 78.71 | View in AlphaFoldDB ↗ |