DPCfam | MC443814
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Residues in low-complexity regions (%) | 16.65 |
| Residues in coiled-coil regions (%) | 0.63 |
| Predicted disordered residues (%) | 6.79 |
| Average transmembrane regions | 1.99 |
| Dominant Pfam architecture(s) | PF08636 |
| Sequences matching dominant architecture (%) | 88.89 |
| Average overlap percent | 85.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A139AVE5 | 93-168 | 76 | TLIEDVWLSVFTPGVPNQRVQAVFQFIFLLMMLSLFGLWWASEWSIHVAVLVFAGAGLWASTTWFLNELQNTPPEV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GJB0-F1 | 2-84 | 98.82 | 85.37 | View in AlphaFoldDB ↗ |