DPCfam | MC443707
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 59 ± 13 aa |
| Residues in low-complexity regions (%) | 0.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01218 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 22.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9ZC86 | 93-154 | 62 | DGKFFATGISVVAHLKSPLIPAMHFNTRYIETSKNWFGGGGDLTPFYPEENETAKFHTAFKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9V3D2-F1 | 172-238 | 95.71 | 95.98 | View in AlphaFoldDB ↗ |