DPCfam | MC443561
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Residues in low-complexity regions (%) | 2.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13148 |
| Sequences matching dominant architecture (%) | 69.09 |
| Average overlap percent | 19.48 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000689013A | 645-768 | 124 | PGSIGSILGRAEAHMIRLSLIYAILDSSESIKKVHLQAAQSFWRYSEASARHIFKETQLSGLAAKIYKIIEKGQVTSTELIKNLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E5AV36-F1 | 280-338 | 47.62 | 97.39 | View in AlphaFoldDB ↗ |