DPCfam | MC443461
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Residues in low-complexity regions (%) | 5.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3S6B3 | 12-113 | 102 | QKVAYTCLSNYLQEHEDETIEIEILPPAIQPPDGIMMQDGLSLGVPKKILVLAYLEARQRFFENNQSTDPSLVAGTLQATKIMLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PMT3-F1 | 1-130 | 98.41 | 88.13 | View in AlphaFoldDB ↗ |