DPCfam | MC443451
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1741 |
|---|---|
| Mean domain length (aa) | 129 ± 17 aa |
| Residues in low-complexity regions (%) | 1.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.2 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08646 |
| Sequences matching dominant architecture (%) | 63.99 |
| Average overlap percent | 85.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006A6FE7A | 110-267 | 158 | EAQKCKIVCSIESINTDWGWFFFGHDANGCNRRVTRIGRNDPRRIAQNEKPLWRCENCRANVTNMSPKYKLHVYVADDSDTCKLM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2QZ79-F1 | 13-142 | 98.36 | 93.57 | View in AlphaFoldDB ↗ |