DPCfam | MC443428
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 148 ± 19 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05704 |
| Sequences matching dominant architecture (%) | 1.3 |
| Average overlap percent | 1.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J9P2K1 | 235-377 | 143 | EPLTVFEYITQVLCWLRLCKLEDAGDGFSCADYAVDHILWFDCLKEDWPMETVVGFRGQSAFDALSTSLDADPESEEYKTAYQAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CIC0-F1 | 238-398 | 99.38 | 97.19 | View in AlphaFoldDB ↗ |