DPCfam | MC442816
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Residues in low-complexity regions (%) | 0.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.7 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04293 |
| Sequences matching dominant architecture (%) | 95.0 |
| Average overlap percent | 33.77 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L0F8M1 | 213-308 | 96 | EDLLLYLITYSPALKDWQRDIISMIREESLYFYPQIETKIINEGWATFWHSRIMRELDLTDAEALDFAVMHSQVVQPSRLQLNPY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37875-F1 | 213-314 | 99.03 | 92.81 | View in AlphaFoldDB ↗ |