DPCfam | MC442770
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 293 ± 54 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.21 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF12307 |
| Sequences matching dominant architecture (%) | 57.62 |
| Average overlap percent | 47.15 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G0H9S5 | 97-330 | 234 | KISERAVYEKIKDNLKRYIELEHEADYSILTTWVIGTYFFPSFGAYPYIHIKAPKGSGKSQCLQFILQTAFNAVKARASLPALRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6Y1F0-F1 | 28-348 | 99.67 | 90.40 | View in AlphaFoldDB ↗ |