DPCfam | MC442622
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.15 |
| Predicted disordered residues (%) | 16.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14771 |
| Sequences matching dominant architecture (%) | 86.01 |
| Average overlap percent | 90.8 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S9B4Z9 | 2-80 | 79 | RARSFDDQKVVLAKQALAETDINSEDLRRLLSGIDFDRGRLELAKFAYAHVADRHNFYRVYDVFTFDASVREMQQYIEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FCT7-F1 | 1-63 | 68.42 | 91.36 | View in AlphaFoldDB ↗ |