DPCfam | MC442542
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 334 ± 57 aa |
| Residues in low-complexity regions (%) | 3.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.95 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F4Z3H2 | 55-435 | 381 | GHDARLISTVAPDASETIHVQLYFSTEMDCNGVTRSISLNSTTESGKVATLDSNSVHCAAVNPNPTTMVGQIPNAWMWEADVTNV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NNE5-F1 | 732-1111 | 99.73 | 86.76 | View in AlphaFoldDB ↗ |