DPCfam | MC442127
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 286 ± 49 aa |
| Residues in low-complexity regions (%) | 30.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.39 |
| Average transmembrane regions | 1.55 |
| Dominant Pfam architecture(s) | PF01476 |
| Sequences matching dominant architecture (%) | 67.59 |
| Average overlap percent | 16.9 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082B6347 | 3728-3938 | 211 | TYTVRTGDTLQSVAQSVWGDANLWYKLAEANGISGNAGLIEGQVLQLPAGVMRNTHNAGTVNPYDPSETIGNLSPTTPKPPKKNK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WM38-F1 | 3-52 | 16.84 | 93.00 | View in AlphaFoldDB ↗ |