DPCfam | MC442112
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04801 |
| Sequences matching dominant architecture (%) | 98.11 |
| Average overlap percent | 25.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K8T9H5 | 279-346 | 68 | LHEFHQGKQIERKELANKLGIPPDEIKQIMAHLAVLRQNKLWHFRLPPDEEFIAEYTEIVDQQNLLWE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9CZT4-F1 | 357-430 | 98.67 | 94.84 | View in AlphaFoldDB ↗ |