DPCfam | MC442039
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Residues in low-complexity regions (%) | 4.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.68 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04015 |
| Sequences matching dominant architecture (%) | 64.86 |
| Average overlap percent | 14.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X0VVC2 | 1-93 | 93 | MLVQNSAVLTKNREVNHSVAGEMVRSGMCSLTGESTPDRAWKSLFKSKDVVGIKVNGLGGKQIATHFGVVKAVVSGLKSAGISEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4I9J6-F1 | 11-92 | 56.92 | 75.36 | View in AlphaFoldDB ↗ |