DPCfam | MC44174
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07728 |
| Sequences matching dominant architecture (%) | 72.03 |
| Average overlap percent | 42.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q3P452 | 64-120 | 57 | FVDLPLGASEDRVLGSLDIEAILSTKTRKLLPGLLARAHEGILYIDEVNLLADHLVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9TLX7-F1 | 109-166 | 98.31 | 85.84 | View in AlphaFoldDB ↗ |