DPCfam | MC441363
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 12 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07837 |
| Sequences matching dominant architecture (%) | 2.17 |
| Average overlap percent | 58.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J4VPX8 | 5-78 | 74 | VHTLPGTSPLSGITKRIKKFYTRFRSPLHQVTERLKGIPLWQMETITPVLVEPWRTRLKTVMDKPADEVCAGWT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9G9L9-F1 | 133-167 | 43.75 | 52.62 | View in AlphaFoldDB ↗ |