DPCfam | MC44133
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Residues in low-complexity regions (%) | 5.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15410 |
| Sequences matching dominant architecture (%) | 54.76 |
| Average overlap percent | 17.2 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006CEC993 | 614-750 | 137 | DEGSEDERATRRVSYLKATWADRGHLESDLELSDNEPILSPHRRAFRKWRPPLFPDDIQKIVRLFEPLPTIYDSCVVAVPQKDQE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M2D4-F1 | 577-713 | 91.10 | 49.23 | View in AlphaFoldDB ↗ |